PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G18280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 342aa    MW: 39094.6 Da    PI: 10.4305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G18280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-15958148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd +l+ +v+q+G++ W++++++m+  ++R +k+c +rw +yl
  ORUFI12G18280.1  9 RQRWRPEEDAILLAYVRQYGPREWSLVSQRMNrpLHRDAKSCLERWKNYL 58
                     89**********************************************97 PP

2Myb_DNA-binding34.16.5e-1164108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  ORUFI12G18280.1  64 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 108
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.683158IPR017930Myb domain
SMARTSM007171.7E-13860IPR001005SANT/Myb domain
SuperFamilySSF466891.13E-209103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-201165IPR009057Homeodomain-like
CDDcd001671.34E-71158No hitNo description
PfamPF139216.3E-141273No hitNo description
PROSITE profilePS5129422.39159113IPR017930Myb domain
SMARTSM007171.4E-963111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-1566107IPR009057Homeodomain-like
CDDcd001671.58E-568109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MQPPPMRERQ RWRPEEDAIL LAYVRQYGPR EWSLVSQRMN RPLHRDAKSC LERWKNYLRP  60
GIKKGSLTDD EQRLVIRLQA KHGNKWKKIA AEVPGRTAKR LGKWWEVFKE KQQRELRDRD  120
RRRLPPPLDG DERGGAGGRY DWLLEDFADK LVNDHHRRMM AAPILPPWMS SSPSSSSSPS  180
VTLSLASAAV APAPAAPPPT WGGGGGGEVV VAELMECCRE MEEGQRAWTA HRKEAAWRMK  240
RVEMQLETER ACRRREAAEE FEAKMRALRE EQAAAVERVE AEYREKMAGL RRDAEAKEQK  300
MAEQWAAKHA RLAKFLDQVA ACRRWPPVEI NGGGGRGPGG GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-1512106798MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-1512106798C-Myb DNA-Binding Domain
1msf_C1e-1512106798C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1333340GGRGPGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0645190.0AB064519.1 Oryza sativa Japonica Group OsRS2 mRNA for transcription factor rough sheath 2 like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620377.10.0PREDICTED: protein rough sheath 2 homolog
RefseqXP_015620378.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotQ94IB10.0RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLA0A0E0RJ010.0A0A0E0RJ01_ORYRU; Uncharacterized protein
STRINGLOC_Os12g38400.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-87MYB family protein